Lineage for d3to4a1 (3to4 A:8-185)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182598Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2182641Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)
  8. 2182665Domain d3to4a1: 3to4 A:8-185 [249965]
    Other proteins in same PDB: d3to4a2, d3to4a3, d3to4b_, d3to4c1, d3to4c2, d3to4d1, d3to4d2
    automated match to d4f7ca1
    complexed with agh, nag

Details for d3to4a1

PDB Entry: 3to4 (more details), 3.1 Å

PDB Description: structure of mouse valpha14vbeta2-mousecd1d-alpha-galactosylceramide
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3to4a1:

Sequence, based on SEQRES records: (download)

>d3to4a1 d.19.1.1 (A:8-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvvr
fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d3to4a1 d.19.1.1 (A:8-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemyasesflhvafqgkyvvrfwg
tswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3to4a1:

Click to download the PDB-style file with coordinates for d3to4a1.
(The format of our PDB-style files is described here.)

Timeline for d3to4a1: