Lineage for d3tded1 (3tde D:5-107)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583236Species Mycobacterium tuberculosis [TaxId:1773] [256098] (1 PDB entry)
  8. 2583246Domain d3tded1: 3tde D:5-107 [249873]
    automated match to d1mxaa1
    complexed with na

Details for d3tded1

PDB Entry: 3tde (more details), 1.85 Å

PDB Description: crystal structure of s-adenosylmethionine synthetase rv1392 from mycobacterium tuberculosis
PDB Compounds: (D:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d3tded1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tded1 d.130.1.0 (D:5-107) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
grlftsesvteghpdkicdaisdsvldallaadprsrvavetlvttgqvhvvgevttsak
eafaditntvrarileigydssdkgfdgatcgvnigigaqspd

SCOPe Domain Coordinates for d3tded1:

Click to download the PDB-style file with coordinates for d3tded1.
(The format of our PDB-style files is described here.)

Timeline for d3tded1: