Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [256098] (1 PDB entry) |
Domain d3tdea3: 3tde A:253-403 [249866] automated match to d1mxaa3 complexed with na |
PDB Entry: 3tde (more details), 1.85 Å
SCOPe Domain Sequences for d3tdea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tdea3 d.130.1.0 (A:253-403) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} lggpmgdagltgrkiivdtyggwarhgggafsgkdpskvdrsaayamrwvaknvvaagla ervevqvayaigkaapvglfvetfgtetedpvkiekaigevfdlrpgaiirdlnllrpiy aptaayghfgrtdvelpweqldkvddlkrai
Timeline for d3tdea3: