Lineage for d3t71a3 (3t71 A:305-495)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772704Species Steccherinum ochraceum [TaxId:92696] [256093] (5 PDB entries)
  8. 2772743Domain d3t71a3: 3t71 A:305-495 [249825]
    automated match to d1gyca3
    complexed with cu, gol, nag, so4

Details for d3t71a3

PDB Entry: 3t71 (more details), 2.15 Å

PDB Description: crystal structure of steccherinum ochraceum laccase obtained by multi- crystals composite data collection technique (90% dose)
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d3t71a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t71a3 b.6.1.0 (A:305-495) automated matches {Steccherinum ochraceum [TaxId: 92696]}
ietdlhplsrngvpgnphqggadcnlnlslgfacgnfvingvsftpptvpvllqicsgan
taadllpsgsvislpsnstieialpagaaggphpfhlhghdfavsesasnstsnyddpiw
rdvvsiggvgdnvtirfctdnpgpwflhchidwhldagfaivfaedipntasanpvpeaw
snlcpsydsah

SCOPe Domain Coordinates for d3t71a3:

Click to download the PDB-style file with coordinates for d3t71a3.
(The format of our PDB-style files is described here.)

Timeline for d3t71a3: