Lineage for d1gyca3 (1gyc A:301-499)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771289Protein Laccase, C-terminal domain [418907] (5 species)
  7. 2771319Species Trametes versicolor, laccase 2 [TaxId:5325] [419321] (1 PDB entry)
  8. 2771320Domain d1gyca3: 1gyc A:301-499 [70750]
    Other proteins in same PDB: d1gyca1, d1gyca2
    complexed with cu, ipa, nag
    has additional insertions and/or extensions that are not grouped together

Details for d1gyca3

PDB Entry: 1gyc (more details), 1.9 Å

PDB Description: crystal structure determination at room temperature of a laccase from trametes versicolor in its oxidised form containing a full complement of copper ions
PDB Compounds: (A:) laccase 2

SCOPe Domain Sequences for d1gyca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyca3 b.6.1.3 (A:301-499) Laccase, C-terminal domain {Trametes versicolor, laccase 2 [TaxId: 5325]}
ietnlhplarmpvpgsptpggvdkalnlafnfngtnffinnasftpptvpvllqilsgaq
taqdllpagsvyplpahstieitlpatalapgaphpfhlhghafavvrsagsttynyndp
ifrdvvstgtpaagdnvtirfqtdnpgpwflhchidfhleagfaivfaedvadvkaanpv
pkawsdlcpiydglseanq

SCOPe Domain Coordinates for d1gyca3:

Click to download the PDB-style file with coordinates for d1gyca3.
(The format of our PDB-style files is described here.)

Timeline for d1gyca3: