| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein Laccase, C-terminal domain [418907] (5 species) |
| Species Trametes versicolor, laccase 2 [TaxId:5325] [419321] (1 PDB entry) |
| Domain d1gyca3: 1gyc A:301-499 [70750] Other proteins in same PDB: d1gyca1, d1gyca2 complexed with cu, ipa, nag has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1gyc (more details), 1.9 Å
SCOPe Domain Sequences for d1gyca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gyca3 b.6.1.3 (A:301-499) Laccase, C-terminal domain {Trametes versicolor, laccase 2 [TaxId: 5325]}
ietnlhplarmpvpgsptpggvdkalnlafnfngtnffinnasftpptvpvllqilsgaq
taqdllpagsvyplpahstieitlpatalapgaphpfhlhghafavvrsagsttynyndp
ifrdvvstgtpaagdnvtirfqtdnpgpwflhchidfhleagfaivfaedvadvkaanpv
pkawsdlcpiydglseanq
Timeline for d1gyca3: