| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Steccherinum ochraceum [TaxId:92696] [256093] (5 PDB entries) |
| Domain d3t71c3: 3t71 C:305-495 [249831] automated match to d1gyca3 complexed with cu, gol, nag, so4 |
PDB Entry: 3t71 (more details), 2.15 Å
SCOPe Domain Sequences for d3t71c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t71c3 b.6.1.0 (C:305-495) automated matches {Steccherinum ochraceum [TaxId: 92696]}
ietdlhplsrngvpgnphqggadcnlnlslgfacgnfvingvsftpptvpvllqicsgan
taadllpsgsvislpsnstieialpagaaggphpfhlhghdfavsesasnstsnyddpiw
rdvvsiggvgdnvtirfctdnpgpwflhchidwhldagfaivfaedipntasanpvpeaw
snlcpsydsah
Timeline for d3t71c3: