Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [256087] (1 PDB entry) |
Domain d3so4a2: 3so4 A:115-238 [249533] automated match to d2p02a2 complexed with act |
PDB Entry: 3so4 (more details), 3.18 Å
SCOPe Domain Sequences for d3so4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3so4a2 d.130.1.0 (A:115-238) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} edigagdqgimfgyatdeskemmplthvlstklilrlqecrekgilpwlrpdsksqvtle yeeveghlkpirvhtivistqhadnvsneeiakgleeevtqkvipkelmddkmlryynps grfv
Timeline for d3so4a2: