Lineage for d3so4a2 (3so4 A:115-238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976427Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2976428Protein automated matches [254617] (15 species)
    not a true protein
  7. 2976477Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [256087] (1 PDB entry)
  8. 2976479Domain d3so4a2: 3so4 A:115-238 [249533]
    automated match to d2p02a2
    complexed with act

Details for d3so4a2

PDB Entry: 3so4 (more details), 3.18 Å

PDB Description: methionine-adenosyltransferase from entamoeba histolytica
PDB Compounds: (A:) Methionine-adenosyltransferase

SCOPe Domain Sequences for d3so4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3so4a2 d.130.1.0 (A:115-238) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
edigagdqgimfgyatdeskemmplthvlstklilrlqecrekgilpwlrpdsksqvtle
yeeveghlkpirvhtivistqhadnvsneeiakgleeevtqkvipkelmddkmlryynps
grfv

SCOPe Domain Coordinates for d3so4a2:

Click to download the PDB-style file with coordinates for d3so4a2.
(The format of our PDB-style files is described here.)

Timeline for d3so4a2: