Lineage for d3smaa_ (3sma A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923433Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 2923434Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 2923450Family c.140.1.0: automated matches [191555] (1 protein)
    not a true family
  6. 2923451Protein automated matches [190957] (7 species)
    not a true protein
  7. 2923493Species Streptomyces rubellomurinus [TaxId:359131] [256086] (1 PDB entry)
  8. 2923494Domain d3smaa_: 3sma A: [249509]
    automated match to d2nyge_
    complexed with aco

Details for d3smaa_

PDB Entry: 3sma (more details), 2 Å

PDB Description: A new N-acetyltransferase fold in the structure and mechanism of the phosphonate biosynthetic enzyme FrbF
PDB Compounds: (A:) FrbF

SCOPe Domain Sequences for d3smaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3smaa_ c.140.1.0 (A:) automated matches {Streptomyces rubellomurinus [TaxId: 359131]}
relvtrdrlasdlaalgvrpggvllvhaslsalgwvcggaqavvlalqdavgkegtlvmp
tfsgdlsdpstwrrppvpedwwpvireqmppfdpdltptrgmgavaecfrraagavrsgh
pqnsfaawgahaeqvvaehglterlgrgspleqvyrldgqvlllgcgfesntsfhlaeyr
taypgrrshrrrvpvpegdrvrwveqedivyfeedfqtmgescltrtpghsrgtvgeaaa
vlygqrafvdlacewmtahrdla

SCOPe Domain Coordinates for d3smaa_:

Click to download the PDB-style file with coordinates for d3smaa_.
(The format of our PDB-style files is described here.)

Timeline for d3smaa_: