![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest |
![]() | Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) ![]() |
![]() | Family c.140.1.0: automated matches [191555] (1 protein) not a true family |
![]() | Protein automated matches [190957] (7 species) not a true protein |
![]() | Species Streptomyces rubellomurinus [TaxId:359131] [256086] (1 PDB entry) |
![]() | Domain d3smaa_: 3sma A: [249509] automated match to d2nyge_ complexed with aco |
PDB Entry: 3sma (more details), 2 Å
SCOPe Domain Sequences for d3smaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3smaa_ c.140.1.0 (A:) automated matches {Streptomyces rubellomurinus [TaxId: 359131]} relvtrdrlasdlaalgvrpggvllvhaslsalgwvcggaqavvlalqdavgkegtlvmp tfsgdlsdpstwrrppvpedwwpvireqmppfdpdltptrgmgavaecfrraagavrsgh pqnsfaawgahaeqvvaehglterlgrgspleqvyrldgqvlllgcgfesntsfhlaeyr taypgrrshrrrvpvpegdrvrwveqedivyfeedfqtmgescltrtpghsrgtvgeaaa vlygqrafvdlacewmtahrdla
Timeline for d3smaa_: