Lineage for d3smab_ (3sma B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2494336Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 2494337Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 2494353Family c.140.1.0: automated matches [191555] (1 protein)
    not a true family
  6. 2494354Protein automated matches [190957] (5 species)
    not a true protein
  7. 2494377Species Streptomyces rubellomurinus [TaxId:359131] [256086] (1 PDB entry)
  8. 2494379Domain d3smab_: 3sma B: [249510]
    automated match to d2nyge_
    complexed with aco

Details for d3smab_

PDB Entry: 3sma (more details), 2 Å

PDB Description: A new N-acetyltransferase fold in the structure and mechanism of the phosphonate biosynthetic enzyme FrbF
PDB Compounds: (B:) FrbF

SCOPe Domain Sequences for d3smab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3smab_ c.140.1.0 (B:) automated matches {Streptomyces rubellomurinus [TaxId: 359131]}
pdrqdrelvtrdrlasdlaalgvrpggvllvhaslsalgwvcggaqavvlalqdavgkeg
tlvmptfsgdlsdpstwrrppvpedwwpvireqmppfdpdltptrgmgavaecfrraaga
vrsghpqnsfaawgahaeqvvaehglterlgrgspleqvyrldgqvlllgcgfesntsfh
laeyrtaypgrrshrrrvpvpegdrvrwveqedivyfeedfqtmgescltrtpghsrgtv
geaaavlygqrafvdlacewmtahrdla

SCOPe Domain Coordinates for d3smab_:

Click to download the PDB-style file with coordinates for d3smab_.
(The format of our PDB-style files is described here.)

Timeline for d3smab_: