Lineage for d3s9ha2 (3s9h A:376-903)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1692262Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1692263Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1692264Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 1692356Protein Family B DNA polymerase [56680] (7 species)
  7. 1692357Species Bacteriophage RB69 [TaxId:12353] [56681] (92 PDB entries)
  8. 1692368Domain d3s9ha2: 3s9h A:376-903 [249317]
    Other proteins in same PDB: d3s9ha1
    automated match to d3qeta2
    protein/DNA complex; complexed with ca, dup; mutant

Details for d3s9ha2

PDB Entry: 3s9h (more details), 1.95 Å

PDB Description: RB69 DNA Polymerase Triple Mutant(L561A/S565G/Y567A) ternary complex with dUpNpp and a dideoxy-terminated primer in the presence of Ca2+
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d3s9ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s9ha2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkalinglagalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

SCOPe Domain Coordinates for d3s9ha2:

Click to download the PDB-style file with coordinates for d3s9ha2.
(The format of our PDB-style files is described here.)

Timeline for d3s9ha2: