SCOPe 2.08: Domain d3s9ha2: 3s9h A:376-903

Lineage for d3s9ha2 (3s9h A:376-903)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Family B DNA polymerase [56680] (7 species)

7. Species Bacteriophage RB69 [TaxId:12353] [56681] (93 PDB entries)

8. Domain d3s9ha2: 3s9h A:376-903 [249317]
   Other proteins in same PDB: d3s9ha1
   automated match to d3qeta2
   protein/DNA complex; complexed with ca, dup; mutant

Details for d3s9ha2

PDB Entry: 3s9h, 1.95 Å

PDB Description: RB69 DNA Polymerase Triple Mutant(L561A/S565G/Y567A) ternary complex with dUpNpp and a dideoxy-terminated primer in the presence of Ca2+

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d3s9ha2:

Sequence; same for both SEQRES and ATOM records:

>d3s9ha2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkalinglagalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

Timeline for d3s9ha2:

• d3s9ha2 first appeared in SCOPe 2.04
  
• d3s9ha2 appears in SCOPe 2.07