Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Mycobacterium avium [TaxId:243243] [256078] (1 PDB entry) |
Domain d3s82b1: 3s82 B:2-106 [249313] automated match to d1mxaa1 complexed with ca, edo, gol, unl |
PDB Entry: 3s82 (more details), 1.73 Å
SCOPe Domain Sequences for d3s82b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s82b1 d.130.1.0 (B:2-106) automated matches {Mycobacterium avium [TaxId: 243243]} sekgrlftsesvteghpdkicdaisdsvldallaqdprsrvavetlvttgqvhvvgevtt takeafaditntvrerildigydssdkgfdgascgvnigigaqsp
Timeline for d3s82b1: