Lineage for d3s82b1 (3s82 B:2-106)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976427Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2976428Protein automated matches [254617] (15 species)
    not a true protein
  7. 2976652Species Mycobacterium avium [TaxId:243243] [256078] (1 PDB entry)
  8. 2976656Domain d3s82b1: 3s82 B:2-106 [249313]
    automated match to d1mxaa1
    complexed with ca, edo, gol, unl

Details for d3s82b1

PDB Entry: 3s82 (more details), 1.73 Å

PDB Description: structure of a s-adenosylmethionine synthetase from mycobacterium avium
PDB Compounds: (B:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d3s82b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s82b1 d.130.1.0 (B:2-106) automated matches {Mycobacterium avium [TaxId: 243243]}
sekgrlftsesvteghpdkicdaisdsvldallaqdprsrvavetlvttgqvhvvgevtt
takeafaditntvrerildigydssdkgfdgascgvnigigaqsp

SCOPe Domain Coordinates for d3s82b1:

Click to download the PDB-style file with coordinates for d3s82b1.
(The format of our PDB-style files is described here.)

Timeline for d3s82b1: