SCOPe 2.04: Domain d3rv3a3: 3rv3 A:331-444

Lineage for d3rv3a3 (3rv3 A:331-444)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)

8. Domain d3rv3a3: 3rv3 A:331-444 [249229]
   Other proteins in same PDB: d3rv3a1, d3rv3a2, d3rv3b1, d3rv3b2
   automated match to d2w6za3
   complexed with adp, mg

Details for d3rv3a3

PDB Entry: 3rv3, 1.91 Å

PDB Description: crystal structure of e.coli biotin carboxylase in complex with two adp and one mg ion

PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d3rv3a3:

Sequence; same for both SEQRES and ATOM records:

>d3rv3a3 b.84.2.1 (A:331-444) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekkl

Timeline for d3rv3a3:

• d3rv3a3 is new in SCOPe 2.04-stable
  
• d3rv3a3 appears in SCOPe 2.05
  
• d3rv3a3 appears in the current release, SCOPe 2.08