SCOPe 2.04: Domain d3rv3b2: 3rv3 B:115-330

Lineage for d3rv3b2 (3rv3 B:115-330)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)

6. Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [56069] (24 PDB entries)

8. Domain d3rv3b2: 3rv3 B:115-330 [249231]
   Other proteins in same PDB: d3rv3a1, d3rv3a3, d3rv3b1, d3rv3b3
   automated match to d1dv2a3
   complexed with adp, mg

Details for d3rv3b2

PDB Entry: 3rv3, 1.91 Å

PDB Description: crystal structure of e.coli biotin carboxylase in complex with two adp and one mg ion

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3rv3b2:

Sequence; same for both SEQRES and ATOM records:

>d3rv3b2 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

Timeline for d3rv3b2:

• d3rv3b2 is new in SCOPe 2.04-stable
  
• d3rv3b2 appears in SCOPe 2.05
  
• d3rv3b2 appears in the current release, SCOPe 2.08