| Class b: All beta proteins [48724] (178 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
| Protein Biotin carboxylase (BC), C-domain [51248] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
| Species Escherichia coli [TaxId:562] [51249] (24 PDB entries) |
| Domain d3rupb3: 3rup B:331-446 [249216] Other proteins in same PDB: d3rupa1, d3rupa2, d3rupa4, d3rupb1, d3rupb2, d3rupb4 automated match to d2w6za3 complexed with adp, ca, cl |
PDB Entry: 3rup (more details), 1.99 Å
SCOPe Domain Sequences for d3rupb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rupb3 b.84.2.1 (B:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl
Timeline for d3rupb3:
View in 3DDomains from other chains: (mouse over for more information) d3rupa1, d3rupa2, d3rupa3, d3rupa4 |