Lineage for d3rupb2 (3rup B:115-330)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585083Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2585090Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2585093Species Escherichia coli [TaxId:562] [56069] (24 PDB entries)
  8. 2585131Domain d3rupb2: 3rup B:115-330 [249215]
    Other proteins in same PDB: d3rupa1, d3rupa3, d3rupa4, d3rupb1, d3rupb3, d3rupb4
    automated match to d1dv2a3
    complexed with adp, ca, cl

Details for d3rupb2

PDB Entry: 3rup (more details), 1.99 Å

PDB Description: crystal structure of e.coli biotin carboxylase in complex with two adp and two ca ions
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3rupb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rupb2 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

SCOPe Domain Coordinates for d3rupb2:

Click to download the PDB-style file with coordinates for d3rupb2.
(The format of our PDB-style files is described here.)

Timeline for d3rupb2: