Lineage for d3rjoa2 (3rjo A:615-941)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006883Family a.118.1.26: ERAP1 C-terminal-like [254170] (3 protein domains)
    Pfam PF11838; PubMed 15893768
  6. 2006893Protein automated matches [254720] (1 species)
    not a true protein
  7. 2006894Species Human (Homo sapiens) [TaxId:9606] [256059] (2 PDB entries)
  8. 2006895Domain d3rjoa2: 3rjo A:615-941 [249127]
    Other proteins in same PDB: d3rjoa1, d3rjoa3
    automated match to d2yd0a4
    complexed with edo

Details for d3rjoa2

PDB Entry: 3rjo (more details), 2.3 Å

PDB Description: Crystal Structure of ERAP1 Peptide Binding Domain
PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d3rjoa2:

Sequence, based on SEQRES records: (download)

>d3rjoa2 a.118.1.26 (A:615-941) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgwdsltgllkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvf
qglnelipmyklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsqllll
acvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfsls
steksqiefalcrtqnkeklqwlldesfkgdkiktqefpqiltligrnpvgyplawqflr
knwnklvqkfelgsssiahmvmgttnqfstrtrleevkgffsslkengsqlrcvqqtiet
ieenigwmdknfdkirvwlqseklerm

Sequence, based on observed residues (ATOM records): (download)

>d3rjoa2 a.118.1.26 (A:615-941) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgwdsltgllkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvf
qglnelipmyklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsqllll
acvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfsls
steksqiefalcrtqnkeklqwlldesfkgdkiktqefpqiltligrnpvgyplawqflr
knwnklvqkfelgsssiahmvmgttnqfstrtrleevkgffsslkensqlrcvqqtieti
eenigwmdknfdkirvwlqseklerm

SCOPe Domain Coordinates for d3rjoa2:

Click to download the PDB-style file with coordinates for d3rjoa2.
(The format of our PDB-style files is described here.)

Timeline for d3rjoa2: