SCOPe 2.07: Domain d3rajl1: 3raj L:1-105

Lineage for d3rajl1 (3raj L:1-105)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3rajl1: 3raj L:1-105 [249080]
   Other proteins in same PDB: d3raja_, d3rajl2
   automated match to d1c12a1

Details for d3rajl1

PDB Entry: 3raj, 3.04 Å

PDB Description: crystal structure of human cd38 in complex with the fab fragment of antibody hb7

PDB Compounds: (L:) light chain of the Fab fragment of antibody HB7

SCOPe Domain Sequences for d3rajl1:

Sequence; same for both SEQRES and ATOM records:

>d3rajl1 b.1.1.0 (L:1-105) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqmtqssssfsvslgdrvtitckasediynrlawyqqkpgnaprllisgatsletgvpsr
fsgsgsgkdytlsitslqtedvatyycqqywstptfgggtkleik

Timeline for d3rajl1:

• d3rajl1 first appeared in SCOPe 2.04
  
• d3rajl1 appears in SCOPe 2.06
  
• d3rajl1 appears in the current release, SCOPe 2.08