SCOPe 2.07: Domain d3raja_: 3raj A:

Lineage for d3raja_ (3raj A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
   contains extra N-terminal all-alpha subdomain
   automatically mapped to Pfam PF02267

6. Protein ADP ribosyl cyclase [56631] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159490] (45 PDB entries)
   Uniprot P28907 45-291

8. Domain d3raja_: 3raj A: [249079]
   Other proteins in same PDB: d3rajl1, d3rajl2
   automated match to d4f45a_

Details for d3raja_

PDB Entry: 3raj, 3.04 Å

PDB Description: crystal structure of human cd38 in complex with the fab fragment of antibody hb7

PDB Compounds: (A:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d3raja_:

Sequence; same for both SEQRES and ATOM records:

>d3raja_ c.23.14.3 (A:) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
wsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeedyqpl
mklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefdtskin
yqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsvevhn
lqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniy

Timeline for d3raja_:

• d3raja_ first appeared in SCOPe 2.04
  
• d3raja_ appears in SCOPe 2.06
  
• d3raja_ appears in the current release, SCOPe 2.08