Lineage for d3r9eb_ (3r9e B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969054Species Escherichia coli [TaxId:562] [233422] (5 PDB entries)
  8. 2969058Domain d3r9eb_: 3r9e B: [249074]
    automated match to d3r95a_
    complexed with coa, dsz

Details for d3r9eb_

PDB Entry: 3r9e (more details), 1.25 Å

PDB Description: crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and aspartyl sulfamoyl adenosine (dsa)
PDB Compounds: (B:) MccE protein

SCOPe Domain Sequences for d3r9eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r9eb_ d.108.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
dvsltpsgikvndeitllypalkyaeelyllinqnkinfiksmawpafvnnisdsvsfie
qsmidnqnekalilfikyktkiagvvsfniidhanktayigywlganfqgkgivtnaink
liqeygdsgvikrfvikcivdnkksnatalrcgftlegvlqkaeilngvsydqniyskvi

SCOPe Domain Coordinates for d3r9eb_:

Click to download the PDB-style file with coordinates for d3r9eb_.
(The format of our PDB-style files is described here.)

Timeline for d3r9eb_: