Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Escherichia coli [TaxId:562] [233422] (5 PDB entries) |
Domain d3r9eb_: 3r9e B: [249074] automated match to d3r95a_ complexed with coa, dsz |
PDB Entry: 3r9e (more details), 1.25 Å
SCOPe Domain Sequences for d3r9eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r9eb_ d.108.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} dvsltpsgikvndeitllypalkyaeelyllinqnkinfiksmawpafvnnisdsvsfie qsmidnqnekalilfikyktkiagvvsfniidhanktayigywlganfqgkgivtnaink liqeygdsgvikrfvikcivdnkksnatalrcgftlegvlqkaeilngvsydqniyskvi
Timeline for d3r9eb_: