Lineage for d3r3ja2 (3r3j A:258-510)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848010Species Plasmodium falciparum [TaxId:36329] [225359] (7 PDB entries)
  8. 2848047Domain d3r3ja2: 3r3j A:258-510 [249027]
    Other proteins in same PDB: d3r3ja1, d3r3jb1, d3r3jc1, d3r3jd1, d3r3je1, d3r3jf1
    automated match to d1bgva1

Details for d3r3ja2

PDB Entry: 3r3j (more details), 3.1 Å

PDB Description: Kinetic and structural characterization of Plasmodium falciparum glutamate dehydrogenase 2
PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d3r3ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r3ja2 c.2.1.0 (A:258-510) automated matches {Plasmodium falciparum [TaxId: 36329]}
knikwggsniraeatgygvvyfaenvlkdlndnlenkkclvsgsgnvaqylvekliekga
ivltmsdsngyilepngftkeqlnyimdiknnqrlrlkeylkysktakyfenqkpwnipc
diafpcatqneinendadlfiqnkckmiveganmpthikalhklkqnniilcpskaanag
gvavsglemsqnsmrlqwthqetdmklqnimksiyeqchntskiylnesdlvaganiagf
lkvadsfleqggl

SCOPe Domain Coordinates for d3r3ja2:

Click to download the PDB-style file with coordinates for d3r3ja2.
(The format of our PDB-style files is described here.)

Timeline for d3r3ja2: