| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [225359] (7 PDB entries) |
| Domain d3r3jb2: 3r3j B:258-510 [249029] Other proteins in same PDB: d3r3ja1, d3r3jb1, d3r3jc1, d3r3jd1, d3r3je1, d3r3jf1 automated match to d1bgva1 |
PDB Entry: 3r3j (more details), 3.1 Å
SCOPe Domain Sequences for d3r3jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r3jb2 c.2.1.0 (B:258-510) automated matches {Plasmodium falciparum [TaxId: 36329]}
knikwggsniraeatgygvvyfaenvlkdlndnlenkkclvsgsgnvaqylvekliekga
ivltmsdsngyilepngftkeqlnyimdiknnqrlrlkeylkysktakyfenqkpwnipc
diafpcatqneinendadlfiqnkckmiveganmpthikalhklkqnniilcpskaanag
gvavsglemsqnsmrlqwthqetdmklqnimksiyeqchntskiylnesdlvaganiagf
lkvadsfleqggl
Timeline for d3r3jb2: