Lineage for d1ltsd_ (1lts D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1787828Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1787829Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 protein domains)
  6. 1787953Protein Heat-labile toxin [50205] (2 species)
  7. 1787954Species Escherichia coli, type IB [TaxId:562] [50206] (21 PDB entries)
  8. 1788005Domain d1ltsd_: 1lts D: [24900]
    Other proteins in same PDB: d1lts.1

Details for d1ltsd_

PDB Entry: 1lts (more details), 1.95 Å

PDB Description: refined structure of e. coli heat labile enterotoxin, a close relative of cholera toxin
PDB Compounds: (D:) heat-labile enterotoxin, subunit b

SCOPe Domain Sequences for d1ltsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltsd_ b.40.2.1 (D:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOPe Domain Coordinates for d1ltsd_:

Click to download the PDB-style file with coordinates for d1ltsd_.
(The format of our PDB-style files is described here.)

Timeline for d1ltsd_: