SCOPe 2.05: Domain d1ltsh_: 1lts H:

Lineage for d1ltsh_ (1lts H:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Heat-labile toxin [50205] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [50206] (21 PDB entries)

8. Domain d1ltsh_: 1lts H: [24904]
   Other proteins in same PDB: d1lts.1

Details for d1ltsh_

PDB Entry: 1lts, 1.95 Å

PDB Description: refined structure of e. coli heat labile enterotoxin, a close relative of cholera toxin

PDB Compounds: (H:) heat-labile enterotoxin, subunit b

SCOPe Domain Sequences for d1ltsh_:

Sequence; same for both SEQRES and ATOM records:

>d1ltsh_ b.40.2.1 (H:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

Timeline for d1ltsh_:

• d1ltsh_ first appeared (with stable ids) in SCOP 1.55
  
• d1ltsh_ appears in SCOPe 2.04
  
• d1ltsh_ appears in SCOPe 2.06
  
• d1ltsh_ appears in the current release, SCOPe 2.08