| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) ![]() |
| Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
| Protein automated matches [190370] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries) |
| Domain d3qi3a_: 3qi3 A: [248898] automated match to d2hd1a_ complexed with mg, pdb, zn |
PDB Entry: 3qi3 (more details), 2.3 Å
SCOPe Domain Sequences for d3qi3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qi3a_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataeigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqk
Timeline for d3qi3a_: