Lineage for d3qi3a_ (3qi3 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1753307Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1753308Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1753393Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1753654Protein automated matches [190370] (1 species)
    not a true protein
  7. 1753655Species Human (Homo sapiens) [TaxId:9606] [187208] (26 PDB entries)
  8. 1753678Domain d3qi3a_: 3qi3 A: [248898]
    automated match to d2hd1a_
    complexed with mg, pdb, zn

Details for d3qi3a_

PDB Entry: 3qi3 (more details), 2.3 Å

PDB Description: Crystal structure of PDE9A(Q453E) in complex with inhibitor BAY73-6691
PDB Compounds: (A:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d3qi3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qi3a_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataeigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqk

SCOPe Domain Coordinates for d3qi3a_:

Click to download the PDB-style file with coordinates for d3qi3a_.
(The format of our PDB-style files is described here.)

Timeline for d3qi3a_: