Lineage for d3pv0g_ (3pv0 G:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256584Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 2256585Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 2256586Family f.58.1.1: MetI-like [161099] (6 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 2256620Protein automated matches [191243] (1 species)
    not a true protein
  7. 2256621Species Escherichia coli K-12 [TaxId:83333] [189709] (8 PDB entries)
  8. 2256632Domain d3pv0g_: 3pv0 G: [248673]
    Other proteins in same PDB: d3pv0a1, d3pv0a2, d3pv0b1, d3pv0b2, d3pv0e_, d3pv0f1, d3pv0f2
    automated match to d3puxg_
    complexed with mal, pgv

Details for d3pv0g_

PDB Entry: 3pv0 (more details), 3.1 Å

PDB Description: crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
PDB Compounds: (G:) Maltose transporter subunit; membrane component of ABC superfamily

SCOPe Domain Sequences for d3pv0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pv0g_ f.58.1.1 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
amvqpksqkarlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwkl
algfsveqadgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkatl
lkgmlifqmfpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgyf
etidssleeaaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdvn
sytlavgmqqylnpqnylwgdfaaaavmsalpitivfllaqr

SCOPe Domain Coordinates for d3pv0g_:

Click to download the PDB-style file with coordinates for d3pv0g_.
(The format of our PDB-style files is described here.)

Timeline for d3pv0g_: