| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.58: MetI-like [161097] (1 superfamily) core: 5 transmembrane helices; flattened bundle |
Superfamily f.58.1: MetI-like [161098] (1 family) ![]() |
| Family f.58.1.1: MetI-like [161099] (6 proteins) Pfam PF00528; Binding-protein-dependent transport system inner membrane component |
| Protein automated matches [191243] (1 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [189709] (8 PDB entries) |
| Domain d3pv0g_: 3pv0 G: [248673] Other proteins in same PDB: d3pv0a1, d3pv0a2, d3pv0b1, d3pv0b2, d3pv0e_, d3pv0f1, d3pv0f2 automated match to d3puxg_ complexed with mal, pgv |
PDB Entry: 3pv0 (more details), 3.1 Å
SCOPe Domain Sequences for d3pv0g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pv0g_ f.58.1.1 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
amvqpksqkarlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwkl
algfsveqadgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkatl
lkgmlifqmfpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgyf
etidssleeaaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdvn
sytlavgmqqylnpqnylwgdfaaaavmsalpitivfllaqr
Timeline for d3pv0g_: