SCOPe 2.05: Domain d3pv0a2: 3pv0 A:236-371

Lineage for d3pv0a2 (3pv0 A:236-371)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (4 families)

5. Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
   probably stems out from the biMOP domain

6. Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)

7. Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)

8. Domain d3pv0a2: 3pv0 A:236-371 [248667]
   Other proteins in same PDB: d3pv0a1, d3pv0b1, d3pv0e_, d3pv0f1, d3pv0f2, d3pv0g_
   automated match to d3puza2
   complexed with mal, pgv

Details for d3pv0a2

PDB Entry: 3pv0, 3.1 Å

PDB Description: crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide

PDB Compounds: (A:) Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein

SCOPe Domain Sequences for d3pv0a2:

Sequence; same for both SEQRES and ATOM records:

>d3pv0a2 b.40.6.3 (A:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgv

Timeline for d3pv0a2:

• d3pv0a2 first appeared in SCOPe 2.04
  
• d3pv0a2 appears in SCOPe 2.06
  
• d3pv0a2 appears in the current release, SCOPe 2.08