Lineage for d3pv0b2 (3pv0 B:236-371)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2400579Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2400663Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 2400683Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 2400684Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 2400714Domain d3pv0b2: 3pv0 B:236-371 [248669]
    Other proteins in same PDB: d3pv0a1, d3pv0b1, d3pv0e_, d3pv0f1, d3pv0f2, d3pv0g_
    automated match to d3puza2
    complexed with mal, pgv

Details for d3pv0b2

PDB Entry: 3pv0 (more details), 3.1 Å

PDB Description: crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
PDB Compounds: (B:) Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein

SCOPe Domain Sequences for d3pv0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pv0b2 b.40.6.3 (B:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgv

SCOPe Domain Coordinates for d3pv0b2:

Click to download the PDB-style file with coordinates for d3pv0b2.
(The format of our PDB-style files is described here.)

Timeline for d3pv0b2: