Lineage for d3pv0f2 (3pv0 F:261-505)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2634215Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 2634216Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 2634217Family f.58.1.1: MetI-like [161099] (6 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 2634224Protein Maltose transport system permease protein MalF [161106] (1 species)
  7. 2634225Species Escherichia coli [TaxId:562] [161107] (10 PDB entries)
    Uniprot P02916 261-504
  8. 2634233Domain d3pv0f2: 3pv0 F:261-505 [248672]
    Other proteins in same PDB: d3pv0a1, d3pv0a2, d3pv0b1, d3pv0b2, d3pv0e_, d3pv0f1, d3pv0g_
    automated match to d2r6gf2
    complexed with mal, pgv

Details for d3pv0f2

PDB Entry: 3pv0 (more details), 3.1 Å

PDB Description: crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
PDB Compounds: (F:) Maltose transporter subunit; membrane component of ABC superfamily

SCOPe Domain Sequences for d3pv0f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pv0f2 f.58.1.1 (F:261-505) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wknftrvftdegiqkpflaifvwtvvfslitvfltvavgmvlaclvqwealrgkavyrvl
lilpyavpsfisilifkglfnqsfgeinmmlsalfgvkpawfsdpttartmliivntwlg
ypymmilcmgllkaipddlyeasamdgagpfqnffkitlpllikpltplmiasfafnfnn
fvliqlltnggpdrlgtttpagytdllvnytyriafeggggqdfglaaaiatlifllvga
laivn

SCOPe Domain Coordinates for d3pv0f2:

Click to download the PDB-style file with coordinates for d3pv0f2.
(The format of our PDB-style files is described here.)

Timeline for d3pv0f2: