Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.58: MetI-like [161097] (1 superfamily) core: 5 transmembrane helices; flattened bundle |
Superfamily f.58.1: MetI-like [161098] (1 family) |
Family f.58.1.1: MetI-like [161099] (6 proteins) Pfam PF00528; Binding-protein-dependent transport system inner membrane component |
Protein Maltose transport system permease protein MalF [161106] (1 species) |
Species Escherichia coli [TaxId:562] [161107] (10 PDB entries) Uniprot P02916 261-504 |
Domain d3pv0f2: 3pv0 F:261-505 [248672] Other proteins in same PDB: d3pv0a1, d3pv0a2, d3pv0b1, d3pv0b2, d3pv0e_, d3pv0f1, d3pv0g_ automated match to d2r6gf2 complexed with mal, pgv |
PDB Entry: 3pv0 (more details), 3.1 Å
SCOPe Domain Sequences for d3pv0f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pv0f2 f.58.1.1 (F:261-505) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]} wknftrvftdegiqkpflaifvwtvvfslitvfltvavgmvlaclvqwealrgkavyrvl lilpyavpsfisilifkglfnqsfgeinmmlsalfgvkpawfsdpttartmliivntwlg ypymmilcmgllkaipddlyeasamdgagpfqnffkitlpllikpltplmiasfafnfnn fvliqlltnggpdrlgtttpagytdllvnytyriafeggggqdfglaaaiatlifllvga laivn
Timeline for d3pv0f2: