Lineage for d3pv0a1 (3pv0 A:2-235)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870265Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)
  7. 2870266Species Escherichia coli [TaxId:562] [102380] (15 PDB entries)
  8. 2870303Domain d3pv0a1: 3pv0 A:2-235 [248666]
    Other proteins in same PDB: d3pv0a2, d3pv0b2, d3pv0e_, d3pv0f1, d3pv0f2, d3pv0g_
    automated match to d3rlfa1
    complexed with pgv

Details for d3pv0a1

PDB Entry: 3pv0 (more details), 3.1 Å

PDB Description: crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
PDB Compounds: (A:) Fused maltose transport subunit, ATP-binding component of ABC superfamily; regulatory protein

SCOPe Domain Sequences for d3pv0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pv0a1 c.37.1.12 (A:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

SCOPe Domain Coordinates for d3pv0a1:

Click to download the PDB-style file with coordinates for d3pv0a1.
(The format of our PDB-style files is described here.)

Timeline for d3pv0a1: