SCOPe 2.04: Domain d3p8ba_: 3p8b A:

Lineage for d3p8ba_ (3p8b A:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.9: RNA polymerase subunits [63393] (3 families)

5. Family g.41.9.3: RpoE2-like [111454] (2 proteins)
   Pfam PF04035

6. Protein automated matches [254713] (1 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [256017] (1 PDB entry)

8. Domain d3p8ba_: 3p8b A: [248439]
   automated match to d1ryqa_
   protein/RNA complex; complexed with bme, gol, zn

Details for d3p8ba_

PDB Entry: 3p8b, 1.8 Å

PDB Description: X-ray crystal structure of Pyrococcus furiosus transcription elongation factor Spt4/5

PDB Compounds: (A:) DNA-directed RNA polymerase, subunit e''

SCOPe Domain Sequences for d3p8ba_:

Sequence; same for both SEQRES and ATOM records:

>d3p8ba_ g.41.9.3 (A:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
sekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkyairvr

Timeline for d3p8ba_:

• d3p8ba_ is new in SCOPe 2.04-stable
  
• d3p8ba_ appears in SCOPe 2.05
  
• d3p8ba_ appears in the current release, SCOPe 2.08