PDB entry 3p8b

View 3p8b on RCSB PDB site
Description: X-ray crystal structure of Pyrococcus furiosus transcription elongation factor Spt4/5
Class: transferase/transcription
Keywords: transcription elongation factor, RNA polymerase, TRANSFERASE-TRANSCRIPTION complex
Deposited on 2010-10-13, released 2011-01-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.239
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-directed RNA polymerase, subunit e''
  Species: Pyrococcus furiosus [TaxId:2261]
  Gene: PF0255, Spt4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8U440 (Start-80)
  Domains in SCOPe 2.04: d3p8ba_
• Chain 'B':
  Compound: Transcription antitermination protein nusG
  Species: Pyrococcus furiosus [TaxId:2261]
  Gene: PF1990, Spt5
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8TZK1
• Chain 'C':
  Compound: DNA-directed RNA polymerase, subunit e''
  Species: Pyrococcus furiosus [TaxId:2261]
  Gene: PF0255, Spt4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8U440 (Start-80)
  Domains in SCOPe 2.04: d3p8bc_
• Chain 'D':
  Compound: Transcription antitermination protein nusG
  Species: Pyrococcus furiosus [TaxId:2261]
  Gene: PF1990, Spt5
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8TZK1
• Heterogens: ZN, BME, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3p8bA (A:)
  mgsshhhhhhssglvprgshmsekacrhchyitsedrcpvcgsrdlseewfdlviivdve
  nseiakkigakvpgkyairvr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3p8bA (A:)
  sekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkyairvr
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >3p8bC (C:)
  mgsshhhhhhssglvprgshmsekacrhchyitsedrcpvcgsrdlseewfdlviivdve
  nseiakkigakvpgkyairvr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3p8bC (C:)
  sekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkyairvr
  

  
  
• Chain 'D':
  No sequence available.