PDB entry 3p8b
View 3p8b on RCSB PDB site
Description: X-ray crystal structure of Pyrococcus furiosus transcription elongation factor Spt4/5
Class: transferase/transcription
Keywords: transcription elongation factor, RNA polymerase, TRANSFERASE-TRANSCRIPTION complex
Deposited on
2010-10-13, released
2011-01-26
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-05-11, with a file datestamp of
2011-05-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.239
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: DNA-directed RNA polymerase, subunit e''
Species: Pyrococcus furiosus [TaxId:2261]
Gene: PF0255, Spt4
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3p8ba_ - Chain 'B':
Compound: Transcription antitermination protein nusG
Species: Pyrococcus furiosus [TaxId:2261]
Gene: PF1990, Spt5
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: DNA-directed RNA polymerase, subunit e''
Species: Pyrococcus furiosus [TaxId:2261]
Gene: PF0255, Spt4
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3p8bc_ - Chain 'D':
Compound: Transcription antitermination protein nusG
Species: Pyrococcus furiosus [TaxId:2261]
Gene: PF1990, Spt5
Database cross-references and differences (RAF-indexed):
- Heterogens: ZN, BME, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3p8bA (A:)
mgsshhhhhhssglvprgshmsekacrhchyitsedrcpvcgsrdlseewfdlviivdve
nseiakkigakvpgkyairvr
Sequence, based on observed residues (ATOM records): (download)
>3p8bA (A:)
sekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkyairvr
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>3p8bC (C:)
mgsshhhhhhssglvprgshmsekacrhchyitsedrcpvcgsrdlseewfdlviivdve
nseiakkigakvpgkyairvr
Sequence, based on observed residues (ATOM records): (download)
>3p8bC (C:)
sekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkyairvr
- Chain 'D':
No sequence available.