SCOPe 2.07: Domain d3p39c_: 3p39 C:

Lineage for d3p39c_ (3p39 C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
   beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]

4. Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family)
   automatically mapped to Pfam PF00600

5. Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
   C-terminal part of Pfam PF00600

6. Protein automated matches [190936] (7 species)
   not a true protein

7. Species Influenza A virus [TaxId:680789] [189731] (3 PDB entries)

8. Domain d3p39c_: 3p39 C: [248410]
   automated match to d3p38a_
   mutant

Details for d3p39c_

PDB Entry: 3p39, 3.14 Å

PDB Description: Crystal structure of the NS1 effector domain W182A mutant from influenza A/Vietnam/1203/2004 (H5N1) virus

PDB Compounds: (C:) nonstructural protein 1

SCOPe Domain Sequences for d3p39c_:

Sequence; same for both SEQRES and ATOM records:

>d3p39c_ d.299.1.1 (C:) automated matches {Influenza A virus [TaxId: 680789]}
kmpasryltdmtleemsrdwfmlmpkqkvagslcikmdqaimdktiilkanfsvifdrle
tlillrafteegaivgeisplpslpghtgedvknaigvliggleandntvrvtetiqrfa
wrn

Timeline for d3p39c_:

• d3p39c_ first appeared in SCOPe 2.04
  
• d3p39c_ appears in SCOPe 2.06
  
• d3p39c_ appears in the current release, SCOPe 2.08