Lineage for d3ouza2 (3ouz A:117-329)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585592Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2585593Protein automated matches [226904] (38 species)
    not a true protein
  7. 2585638Species Campylobacter jejuni [TaxId:192222] [256007] (2 PDB entries)
  8. 2585641Domain d3ouza2: 3ouz A:117-329 [248347]
    Other proteins in same PDB: d3ouza1, d3ouza3, d3ouza4, d3ouzb1, d3ouzb3
    automated match to d1ulza3
    complexed with adp, fmt, gol, mg, mlt, srt, tla

Details for d3ouza2

PDB Entry: 3ouz (more details), 1.9 Å

PDB Description: crystal structure of biotin carboxylase-adp complex from campylobacter jejuni
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d3ouza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ouza2 d.142.1.0 (A:117-329) automated matches {Campylobacter jejuni [TaxId: 192222]}
kskakqvmqragvpvipgsdgalagaeaakklakeigypvilkaaaggggrgmrvvenek
dlekaywsaeseamtafgdgtmymekyiqnprhievqvigdsfgnvihvgerdcsmqrrh
qklieespailldektrtrlhetaikaakaigyegagtfeflvdknldfyfiemntrlqv
ehcvsemvsgidiieqmikvaegyalpsqesik

SCOPe Domain Coordinates for d3ouza2:

Click to download the PDB-style file with coordinates for d3ouza2.
(The format of our PDB-style files is described here.)

Timeline for d3ouza2: