Lineage for d3ouza1 (3ouz A:1-116)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470597Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2470598Protein automated matches [226903] (39 species)
    not a true protein
  7. 2470635Species Campylobacter jejuni [TaxId:192222] [256006] (2 PDB entries)
  8. 2470638Domain d3ouza1: 3ouz A:1-116 [248346]
    Other proteins in same PDB: d3ouza2, d3ouza3, d3ouza4, d3ouzb2, d3ouzb3
    automated match to d1ulza2
    complexed with adp, fmt, gol, mg, mlt, srt, tla

Details for d3ouza1

PDB Entry: 3ouz (more details), 1.9 Å

PDB Description: crystal structure of biotin carboxylase-adp complex from campylobacter jejuni
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d3ouza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ouza1 c.30.1.0 (A:1-116) automated matches {Campylobacter jejuni [TaxId: 192222]}
meiksilianrgeialralrtikemgkkaicvyseadkdalylkyadasicigkarsses
ylnipaiiaaaeiaeadaifpgygflsenqnfveicakhnikfigpsveamnlmsd

SCOPe Domain Coordinates for d3ouza1:

Click to download the PDB-style file with coordinates for d3ouza1.
(The format of our PDB-style files is described here.)

Timeline for d3ouza1: