Lineage for d3ojea_ (3oje A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842037Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2842043Species Bacillus cereus [TaxId:226900] [192761] (6 PDB entries)
  8. 2842060Domain d3ojea_: 3oje A: [248306]
    automated match to d2qioa_

Details for d3ojea_

PDB Entry: 3oje (more details), 3.02 Å

PDB Description: Crystal Structure of the Bacillus cereus Enoyl-Acyl Carrier Protein Reductase (Apo form)
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)

SCOPe Domain Sequences for d3ojea_:

Sequence, based on SEQRES records: (download)

>d3ojea_ c.2.1.2 (A:) Enoyl-ACP reductase {Bacillus cereus [TaxId: 226900]}
mellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqes
lvlpcdvtndeeltacfetikqevgtihgvahciafanrddlkgefvdtsrdgfllaqni
safsltavareakkvmteggniltltylggervvknynvmgvakasleasvkylandlgq
hgirvnaisagpirtlsakgvgdfnsilreieeraplrrtttqeevgdtavflfsdlarg
vtgenihvdsgyhilg

Sequence, based on observed residues (ATOM records): (download)

>d3ojea_ c.2.1.2 (A:) Enoyl-ACP reductase {Bacillus cereus [TaxId: 226900]}
mellqgktfvvmgvanqrsiawgiarslhnagakliftyagerlernvreladtlegqes
lvlpcdvtndeeltacfetikqevgtihgvahciafanrddqnisafsltavareakkvm
teggniltltylgvakasleasvkylandlgqhgirvnaisagpirtldfnsilreieer
aplrrtttqeevgdtavflfsdlargvtgenihvdsgyhilg

SCOPe Domain Coordinates for d3ojea_:

Click to download the PDB-style file with coordinates for d3ojea_.
(The format of our PDB-style files is described here.)

Timeline for d3ojea_: