Lineage for d3oixc_ (3oix C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091323Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2091860Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2091861Protein automated matches [190048] (21 species)
    not a true protein
  7. 2091993Species Streptococcus mutans [TaxId:1309] [255997] (2 PDB entries)
  8. 2092000Domain d3oixc_: 3oix C: [248276]
    automated match to d2b4gb_
    complexed with fmn, gol

Details for d3oixc_

PDB Entry: 3oix (more details), 2.4 Å

PDB Description: crystal structure of the putative dihydroorotate dehydrogenase from streptococcus mutans
PDB Compounds: (C:) Putative dihydroorotate dehydrogenase; dihydroorotate oxidase

SCOPe Domain Sequences for d3oixc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oixc_ c.1.4.0 (C:) automated matches {Streptococcus mutans [TaxId: 1309]}
vsthttigsfdfdnclmnaagvycmtreelaaidhseagsfvtktgtleeragnpqprya
dtklgsinsmglpnlginyyldyvtelqkqpdsknhflslvgmspeethtilkmveasky
qglvelnlscpnvpgkpqiaydfettdqilsevftyftkplgiklppyfdivhfdqaaai
fnkypltfvncinsignglviedetvvikpkngfggiggdyvkptalanvhafykrlnps
iqiigtggvktgrdafehilcgasmvqigtalhqegpqifkritkelkaimtekgyetle
dfrgklnama

SCOPe Domain Coordinates for d3oixc_:

Click to download the PDB-style file with coordinates for d3oixc_.
(The format of our PDB-style files is described here.)

Timeline for d3oixc_: