Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Streptococcus mutans [TaxId:1309] [255997] (2 PDB entries) |
Domain d3oixc_: 3oix C: [248276] automated match to d2b4gb_ complexed with fmn, gol |
PDB Entry: 3oix (more details), 2.4 Å
SCOPe Domain Sequences for d3oixc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oixc_ c.1.4.0 (C:) automated matches {Streptococcus mutans [TaxId: 1309]} vsthttigsfdfdnclmnaagvycmtreelaaidhseagsfvtktgtleeragnpqprya dtklgsinsmglpnlginyyldyvtelqkqpdsknhflslvgmspeethtilkmveasky qglvelnlscpnvpgkpqiaydfettdqilsevftyftkplgiklppyfdivhfdqaaai fnkypltfvncinsignglviedetvvikpkngfggiggdyvkptalanvhafykrlnps iqiigtggvktgrdafehilcgasmvqigtalhqegpqifkritkelkaimtekgyetle dfrgklnama
Timeline for d3oixc_: