SCOPe 2.04: Domain d3ohba1: 3ohb A:-2-389

Lineage for d3ohba1 (3ohb A:-2-389)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)

6. Protein automated matches [231300] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231489] (6 PDB entries)

8. Domain d3ohba1: 3ohb A:-2-389 [248272]
   Other proteins in same PDB: d3ohba2
   automated match to d3mfha1
   protein/DNA complex; complexed with dcp, mg, so4

Details for d3ohba1

PDB Entry: 3ohb, 2 Å

PDB Description: yeast dna polymerase eta extending from an 8-oxog lesion

PDB Compounds: (A:) DNA Polymerase ETA

SCOPe Domain Sequences for d3ohba1:

Sequence; same for both SEQRES and ATOM records:

>d3ohba1 e.8.1.7 (A:-2-389) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dphmskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwn
siiavsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpak
qisvedhkvslepyrresrkalaifkwacdlverasidevfldlgricfnmlmfdneyel
tgdlklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvi
lalgsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldc
gkfeitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydr
stsnidplktadlaeklfklsrgryglplssr

Timeline for d3ohba1:

• d3ohba1 is new in SCOPe 2.04-stable
  
• d3ohba1 appears in SCOPe 2.05
  
• d3ohba1 appears in the current release, SCOPe 2.08