| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
| Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein automated matches [231300] (5 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231489] (6 PDB entries) |
| Domain d3ohba1: 3ohb A:1-389 [248272] Other proteins in same PDB: d3ohba2, d3ohba3 automated match to d3mfha1 protein/DNA complex; complexed with dcp, mg, so4 |
PDB Entry: 3ohb (more details), 2 Å
SCOPe Domain Sequences for d3ohba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ohba1 e.8.1.7 (A:1-389) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
vedhkvslepyrresrkalaifkwacdlverasidevfldlgricfnmlmfdneyeltgd
lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
nidplktadlaeklfklsrgryglplssr
Timeline for d3ohba1: