Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Burkholderia sp. [TaxId:269483] [255988] (1 PDB entry) |
Domain d3nxlc1: 3nxl C:158-465 [248101] automated match to d4hn8a2 complexed with co3, mg |
PDB Entry: 3nxl (more details), 1.89 Å
SCOPe Domain Sequences for d3nxlc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nxlc1 c.1.11.0 (C:158-465) automated matches {Burkholderia sp. [TaxId: 269483]} egqqrdavpmlaylfyigdrgrtdlpyrdeaqartpwfrlrneealtpaaiarqaeaavd rygfadfklkggvmagademeaiaaikacfpdaratldpngawsldeavalcrgqghlla yaedpcgpeggysgrevmaefrratgiptatnmiatdwrqmdhavrlqavdipladphfw tmqgsvrlaqlcrdwgltwgshsnnhfdvslamfthaaaaapgtitaidthwiwqegdar ltreplkivggqvavperpglgieldmaqveaahalykevggtarddavamrylvpgwty dpkrpsfg
Timeline for d3nxlc1: