Lineage for d3nxlc1 (3nxl C:158-465)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837344Species Burkholderia sp. [TaxId:269483] [255988] (1 PDB entry)
  8. 2837347Domain d3nxlc1: 3nxl C:158-465 [248101]
    automated match to d4hn8a2
    complexed with co3, mg

Details for d3nxlc1

PDB Entry: 3nxl (more details), 1.89 Å

PDB Description: crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
PDB Compounds: (C:) glucarate dehydratase

SCOPe Domain Sequences for d3nxlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nxlc1 c.1.11.0 (C:158-465) automated matches {Burkholderia sp. [TaxId: 269483]}
egqqrdavpmlaylfyigdrgrtdlpyrdeaqartpwfrlrneealtpaaiarqaeaavd
rygfadfklkggvmagademeaiaaikacfpdaratldpngawsldeavalcrgqghlla
yaedpcgpeggysgrevmaefrratgiptatnmiatdwrqmdhavrlqavdipladphfw
tmqgsvrlaqlcrdwgltwgshsnnhfdvslamfthaaaaapgtitaidthwiwqegdar
ltreplkivggqvavperpglgieldmaqveaahalykevggtarddavamrylvpgwty
dpkrpsfg

SCOPe Domain Coordinates for d3nxlc1:

Click to download the PDB-style file with coordinates for d3nxlc1.
(The format of our PDB-style files is described here.)

Timeline for d3nxlc1: