Lineage for d3nvzj1 (3nvz J:2-92)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1638761Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1638928Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 1639085Protein automated matches [231466] (4 species)
    not a true protein
  7. 1639086Species Cow (Bos taurus) [TaxId:9913] [232069] (9 PDB entries)
  8. 1639090Domain d3nvzj1: 3nvz J:2-92 [248071]
    Other proteins in same PDB: d3nvza2, d3nvzb1, d3nvzb2, d3nvzc1, d3nvzc2, d3nvzj2, d3nvzk1, d3nvzk2, d3nvzl1, d3nvzl2
    automated match to d3etrl1
    complexed with fad, fes, i3a, mos, mte

Details for d3nvzj1

PDB Entry: 3nvz (more details), 1.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Indole-3-Aldehyde
PDB Compounds: (J:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvzj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvzj1 d.15.4.2 (J:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3nvzj1:

Click to download the PDB-style file with coordinates for d3nvzj1.
(The format of our PDB-style files is described here.)

Timeline for d3nvzj1: