| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
| Protein automated matches [231466] (4 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [232069] (9 PDB entries) |
| Domain d3nvzj1: 3nvz J:2-92 [248071] Other proteins in same PDB: d3nvza2, d3nvzb1, d3nvzb2, d3nvzc1, d3nvzc2, d3nvzj2, d3nvzk1, d3nvzk2, d3nvzl1, d3nvzl2 automated match to d3etrl1 complexed with fad, fes, i3a, mos, mte |
PDB Entry: 3nvz (more details), 1.6 Å
SCOPe Domain Sequences for d3nvzj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvzj1 d.15.4.2 (J:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig
Timeline for d3nvzj1: