SCOPe 2.04: Domain d3nvzb1: 3nvz B:224-414

Lineage for d3nvzb1 (3nvz B:224-414)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
   automatically mapped to Pfam PF00941

6. Protein automated matches [232070] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232074] (10 PDB entries)

8. Domain d3nvzb1: 3nvz B:224-414 [248067]
   Other proteins in same PDB: d3nvza1, d3nvza2, d3nvzb2, d3nvzc1, d3nvzc2, d3nvzj1, d3nvzj2, d3nvzk2, d3nvzl1, d3nvzl2
   automated match to d3eub31
   complexed with fad, fes, i3a, mos, mte

Details for d3nvzb1

PDB Entry: 3nvz, 1.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Indole-3-Aldehyde

PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvzb1:

Sequence; same for both SEQRES and ATOM records:

>d3nvzb1 d.145.1.3 (B:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

Timeline for d3nvzb1:

• d3nvzb1 is new in SCOPe 2.04-stable
  
• d3nvzb1 appears in SCOPe 2.05
  
• d3nvzb1 appears in the current release, SCOPe 2.08