| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) ![]() automatically mapped to Pfam PF03450 |
| Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
| Protein automated matches [232090] (5 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [232091] (11 PDB entries) |
| Domain d3ns1k2: 3ns1 K:415-528 [248010] Other proteins in same PDB: d3ns1a1, d3ns1a2, d3ns1b1, d3ns1c1, d3ns1c2, d3ns1j1, d3ns1j2, d3ns1k1, d3ns1l1, d3ns1l2 automated match to d3eub32 complexed with fad, fes, mos, mte, pm6 |
PDB Entry: 3ns1 (more details), 2.6 Å
SCOPe Domain Sequences for d3ns1k2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ns1k2 d.87.2.0 (K:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3ns1k2: