PDB entry 3ns1

View 3ns1 on RCSB PDB site
Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with 6-Mercaptopurine
Class: oxidoreductase
Keywords: xanthine oxidase, hypoxanthine, substrate orientation, hydroxylase, OXIDOREDUCTASE
Deposited on 2010-07-01, released 2010-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ns1a1, d3ns1a2
  • Chain 'B':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ns1b1, d3ns1b2
  • Chain 'C':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ns1c1, d3ns1c2
  • Chain 'J':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ns1j1, d3ns1j2
  • Chain 'K':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ns1k1, d3ns1k2
  • Chain 'L':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ns1l1, d3ns1l2
  • Heterogens: FES, FAD, MTE, MOS, PM6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ns1A (A:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ns1B (B:)
    pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
    ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
    svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
    llsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrt
    isalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltv
    lkklg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ns1C (C:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkfttlcvtgapgnc
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ns1J (J:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfak
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ns1K (K:)
    pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
    ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
    svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
    llsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrt
    isalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltv
    lkklg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ns1L (L:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkfttlcvtgapgnc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ns1L (L:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkftt